PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00089g02006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 263aa    MW: 29612.8 Da    PI: 8.704
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00089g02006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.2e-401877362
                    zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                              e+a+kcprCdstntkfCyynnysl+qPryfCk+CrryWtkGG+lrnvPvGgg+rknk+ s
  Niben101Scf00089g02006.1 18 EQAQKCPRCDSTNTKFCYYNNYSLTQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRIS 77
                              7899*****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-28575IPR003851Zinc finger, Dof-type
PfamPF027011.1E-331975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2832175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MLVCTKQDQE KKTRPAAEQA QKCPRCDSTN TKFCYYNNYS LTQPRYFCKS CRRYWTKGGT  60
LRNVPVGGGC RKNKRISSKR SQDQSLTNSP NNAISSITPT SYDSSSDLSL AFARLQKQAN  120
GNLGIEENDN MAMMYNNHGN NIAPTSFLDT LRGGFLETPN GFQYQNLYYG NIIGSNDNNM  180
GQVQNGDMGR NYDQEMSGGK IVKQEMCNIA REGENNRILW GFPWQINGDM NNMSDFEASN  240
RQQNWNTGFG GSSWHGLVNS PLM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598584.10.0PREDICTED: dof zinc finger protein DOF2.1-like
RefseqXP_016489685.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLM1CDP11e-103M1CDP1_SOLTU; Uncharacterized protein
TrEMBLM1CDP21e-103M1CDP2_SOLTU; Uncharacterized protein
TrEMBLQ6L3K21e-103Q6L3K2_SOLDE; Dof domain, zinc finger family protein
STRINGPGSC0003DMT4000652711e-102(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.14e-42Dof family protein